Blepharisma nuclear code: Difference between revisions

Content deleted Content added
No edit summary
Changing short description from "An alternative genetic code found in the nuclear genome of some heterotrich ciliates" to "Alternative genetic code in some heterotrich ciliates"
 
(14 intermediate revisions by 8 users not shown)
Line 1:
{{Short description|Alternative genetic code in some heterotrich ciliates}}
'''The Blepharisma nuclear code''' (translation table 15) is a [[genetic code]] found in the nuclei of ''[[Blepharisma]]''.
{{DISPLAYTITLE:''Blepharisma'' nuclear code}}
!'''The !!CodeBlepharisma 10nuclear code''' (translation table 15) is a [[genetic code]] found in the nuclei of ''[[Blepharisma]]''.<ref>{{cite web |url=http://www.bioinformatics.org/jambw/2/3/TranslationTables.html#SG15 |title=The Genetic Codes |author1=Andrzej Elzanowski |author2=Jim Ostell |date=26 September 1996 |publisher=National Center for Biotechnology Information |accessdate=20 January 2017 |archiveurl=httphttps://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html#SG15 |archivedate=2014 JanuaryMarch 20172016 |deadurlurl-status=nolive }}</ref> !! Standard
 
==Code==
 
{{Genetic code
:<code>&nbsp;&nbsp;&nbsp;[[Amino acid|AAs]] = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>
:<code>[[Start codon|Starts]] = -----------------------------------M----------------------------</code>
:<code>&nbsp;[[DNA#Nucleobase_classification|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG</code>
|:<code>&nbsp;Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG</code>
|:<code>&nbsp;Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG</code>
 
}}
Bases: [[adenine]] (A), [[cytosine]] (C), [[guanine]] (G) and [[thymine]] (T) or [[uracil]] (U).
 
Amino acids: [[Alanine]] (Ala, A), [[Arginine]] (Arg, R), [[Asparagine]] (Asn, N), [[Aspartic acid]] (Asp, D), [[Cysteine]] (Cys, C), [[Glutamic acid]] (Glu, E), [[Glutamine]] (Gln, Q), [[Glycine]] (Gly, G), [[Histidine]] (His, H), [[Isoleucine]] (Ile, I), [[Leucine]] (Leu, L), [[Lysine]] (Lys, K), [[Methionine]] (Met, M), [[Phenylalanine]] (Phe, F), [[Proline]] (Pro, P), [[Serine]] (Ser, S), [[Threonine]] (Thr, T), [[Tryptophan]] (Trp, W), [[Tyrosine]] (Tyr, Y), [[Valine]] (Val, V)
 
==Differences from the standard code==
 
{|class="wikitable"
{|class="wikitable" style="border: none; text-align: center;"
|+Differences from the [[standard code]]:
|+
|-
! DNA codons !! RNA codons !! This code (15) !! style="border: none; width: 1px;" | !! [[DNA codon table|Standard code]] (1)
! !!Code 10<ref>{{cite web |url=http://www.bioinformatics.org/jambw/2/3/TranslationTables.html#SG15 |title=The Genetic Codes |author1=Andrzej Elzanowski |author2=Jim Ostell |date=26 September 1996 |publisher=National Center for Biotechnology Information |accessdate=20 January 2017 |archiveurl=http://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html |archivedate=20 January 2017 |deadurl=no}}</ref> !! Standard
|-
| <code>TAG</code> || <code>UAG</code> || style="background-color:#b3dec0;" | <code>Gln</code> <code>(Q)</code> || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | <code>STOP = Ter</code> <code>(*)</code>
| UAG || Gln || Ter
|}
 
==Systematic range and comments==
Ciliata: ''[[Blepharisma]]''<ref>{{Cite journal|author=A Liang, K Heckman|last-author-amp=yes|date=1993|workjournal= Naturwissenschaften|volume=80|pages=225–226|title=Blepharisma uses UAA as a termination codon|issue=5|doi=10.1007/bf01175738|pmid=7685500|bibcode=1993NW.....80..225L|s2cid=6219316}}</ref>
 
==See also==
Line 26 ⟶ 32:
 
==References==
*{{NLM Thiscontent}}<ref articlename="NCBI">{{cite containsweb public| ___domainfirst1 text= fromAndrzej the| last1 [[National= CenterElzanowski for| Biotechnologyfirst2 = Jim Information|NCBI]] pagelast2 compiled= byOstell Andrzej| (Anjay)first3 Elzanowski= andDetlef Jim| Ostell.<reflast3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style ="NCBI">[http vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes]|access-date=3 July 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}</ref>
{{Reflist|refs=
}}
 
==External links==
*
 
[[Category:Molecular genetics]]