Blepharisma nuclear code: Difference between revisions

Revision as of 06:14, 30 August 2017

Latest revision as of 09:01, 20 July 2025

(12 intermediate revisions by 6 users not shown)

Line 1:

{{Short description|Alternative genetic code in some heterotrich ciliates}}

'''The Blepharisma nuclear code''' (translation table 15) is a [[genetic code]] found in the nuclei of ''[[Blepharisma]]''.

{{DISPLAYTITLE:''Blepharisma'' nuclear code}}

!'''The !!CodeBlepharisma 10nuclear code''' (translation table 15) is a [[genetic code]] found in the nuclei of ''[[Blepharisma]]''.<ref>{{cite web |url=http://www.bioinformatics.org/jambw/2/3/TranslationTables.html#SG15 |title=The Genetic Codes |author1=Andrzej Elzanowski |author2=Jim Ostell |date=26 September 1996 |publisher=National Center for Biotechnology Information |accessdate=20 January 2017 |archiveurl=https://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html#SG15 |archivedate=14 March 2016 |deadurl=no |dfurl-status=live }}</ref> !! Standard

==Code==

{{Genetic code

:<code>&nbsp;&nbsp;&nbsp;[[Amino acid|AAs]] = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>

:<code>[[Start codon|Starts]] = -----------------------------------M----------------------------</code>

:<code>&nbsp;[[DNA#Nucleobase_classification|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG</code>

|:<code>&nbsp;Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG</code>

|:<code>&nbsp;Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG</code>

}}

Bases: [[adenine]] (A), [[cytosine]] (C), [[guanine]] (G) and [[thymine]] (T) or [[uracil]] (U).

Amino acids: [[Alanine]] (Ala, A), [[Arginine]] (Arg, R), [[Asparagine]] (Asn, N), [[Aspartic acid]] (Asp, D), [[Cysteine]] (Cys, C), [[Glutamic acid]] (Glu, E), [[Glutamine]] (Gln, Q), [[Glycine]] (Gly, G), [[Histidine]] (His, H), [[Isoleucine]] (Ile, I), [[Leucine]] (Leu, L), [[Lysine]] (Lys, K), [[Methionine]] (Met, M), [[Phenylalanine]] (Phe, F), [[Proline]] (Pro, P), [[Serine]] (Ser, S), [[Threonine]] (Thr, T), [[Tryptophan]] (Trp, W), [[Tyrosine]] (Tyr, Y), [[Valine]] (Val, V)

==Differences from the standard code==

{|class="wikitable"

{|class="wikitable" style="border: none; text-align: center;"

|+Differences from the [[standard code]]:

|+

|-

! DNA codons !! RNA codons !! This code (15) !! style="border: none; width: 1px;" | !! [[DNA codon table|Standard code]] (1)

! !!Code 10<ref>{{cite web |url=http://www.bioinformatics.org/jambw/2/3/TranslationTables.html#SG15 |title=The Genetic Codes |author1=Andrzej Elzanowski |author2=Jim Ostell |date=26 September 1996 |publisher=National Center for Biotechnology Information |accessdate=20 January 2017 |archiveurl=https://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html#SG15 |archivedate=14 March 2016 |deadurl=no |df= }}</ref> !! Standard

|-

| <code>TAG</code> || <code>UAG</code> || style="background-color:#b3dec0;" | <code>Gln</code> <code>(Q)</code> || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | <code>STOP = Ter</code> <code>(*)</code>

| UAG || Gln || Ter

|}

==Systematic range and comments==

Ciliata: ''[[Blepharisma]]''<ref>{{Cite journal|author=A Liang, K Heckman|last-author-amp=yes|date=1993|workjournal= Naturwissenschaften|volume=80|pages=225–226|title=Blepharisma uses UAA as a termination codon|issue=5|doi=10.1007/bf01175738|pmid=7685500|bibcode=1993NW.....80..225L|s2cid=6219316}}</ref>

==See also==

Line 26 ⟶ 32:

==References==

*{{NLM Thiscontent}}<ref articlename="NCBI">{{cite containsweb public| ___domainfirst1 text= fromAndrzej the| last1 [[National= CenterElzanowski for| Biotechnologyfirst2 = Jim Information|NCBI]] pagelast2 compiled= byOstell Andrzej| (Anjay)first3 Elzanowski= andDetlef Jim| Ostell.<reflast3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url="NCBI">[https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes]|access-date=3 July 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}</ref>

{{Reflist|refs=

}}

==External links==

*

[[Category:Molecular genetics]]