Content deleted Content added
KolbertBot (talk | contribs) m Bot: HTTP→HTTPS |
LucasBrown (talk | contribs) Changing short description from "An alternative genetic code found in the nuclear genome of some heterotrich ciliates" to "Alternative genetic code in some heterotrich ciliates" |
||
(12 intermediate revisions by 6 users not shown) | |||
Line 1:
{{Short description|Alternative genetic code in some heterotrich ciliates}}
{{DISPLAYTITLE:''Blepharisma'' nuclear code}}
==Code==
:<code> [[Amino acid|AAs]] = FFLLSSSSYY*QCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>
:<code>[[Start codon|Starts]] = -----------------------------------M----------------------------</code>
:<code> [[DNA#Nucleobase_classification|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG</code>
Bases: [[adenine]] (A), [[cytosine]] (C), [[guanine]] (G) and [[thymine]] (T) or [[uracil]] (U).
Amino acids: [[Alanine]] (Ala, A), [[Arginine]] (Arg, R), [[Asparagine]] (Asn, N), [[Aspartic acid]] (Asp, D), [[Cysteine]] (Cys, C), [[Glutamic acid]] (Glu, E), [[Glutamine]] (Gln, Q), [[Glycine]] (Gly, G), [[Histidine]] (His, H), [[Isoleucine]] (Ile, I), [[Leucine]] (Leu, L), [[Lysine]] (Lys, K), [[Methionine]] (Met, M), [[Phenylalanine]] (Phe, F), [[Proline]] (Pro, P), [[Serine]] (Ser, S), [[Threonine]] (Thr, T), [[Tryptophan]] (Trp, W), [[Tyrosine]] (Tyr, Y), [[Valine]] (Val, V)
==Differences from the standard code==
{|class="wikitable" style="border: none; text-align: center;"
|+
|-
! DNA codons !! RNA codons !! This code (15) !! style="border: none; width: 1px;" | !! [[DNA codon table|Standard code]] (1)
▲! !!Code 10<ref>{{cite web |url=http://www.bioinformatics.org/jambw/2/3/TranslationTables.html#SG15 |title=The Genetic Codes |author1=Andrzej Elzanowski |author2=Jim Ostell |date=26 September 1996 |publisher=National Center for Biotechnology Information |accessdate=20 January 2017 |archiveurl=https://web.archive.org/web/20160314155647/http://www.bioinformatics.org/JaMBW/2/3/TranslationTables.html#SG15 |archivedate=14 March 2016 |deadurl=no |df= }}</ref> !! Standard
|-
| <code>TAG</code> || <code>UAG</code> || style="background-color:#b3dec0;" | <code>Gln</code> <code>(Q)</code> || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | <code>STOP = Ter</code> <code>(*)</code>
|}
==Systematic range and comments==
Ciliata: ''[[Blepharisma]]''<ref>{{Cite journal|author=A Liang, K Heckman
==See also==
Line 26 ⟶ 32:
==References==
{{Reflist|refs=
}}
[[Category:Molecular genetics]]
|