Content deleted Content added
m Centering codons in the table. |
Copyedit. |
||
(11 intermediate revisions by 10 users not shown) | |||
Line 1:
{{Short description|
{{DISPLAYTITLE:''Condylostoma'' nuclear code}}
The '''''Condylostoma'' nuclear code''' (translation table 28) is a [[genetic code]] used by the [[nuclear genome]] of the [[heterotrich]] [[ciliate]] ''[[Condylostoma]] magnum''.<ref>{{Cite journal|last=Heaphy|first=Stephen M.|last2=Mariotti|first2=Marco|last3=Gladyshev|first3=Vadim N.|last4=Atkins|first4=John F.|last5=Baranov|first5=Pavel V.|date=2016-11-01|title=Novel Ciliate Genetic Code Variants Including the Reassignment of All Three Stop Codons to Sense Codons in ''Condylostoma magnum''
▲{{Short description|An alternative genetic code found in the nuclear genome of some ciliates}}
▲The '''''Condylostoma'' nuclear code''' (translation table 28) is a [[genetic code]] used by the [[nuclear genome]] of the [[heterotrich]] [[ciliate]] ''[[Condylostoma]] magnum''.<ref>{{Cite journal|last=Heaphy|first=Stephen M.|last2=Mariotti|first2=Marco|last3=Gladyshev|first3=Vadim N.|last4=Atkins|first4=John F.|last5=Baranov|first5=Pavel V.|date=2016-11-01|title=Novel Ciliate Genetic Code Variants Including the Reassignment of All Three Stop Codons to Sense Codons in ''Condylostoma magnum''|url=http://mbe.oxfordjournals.org/content/33/11/2885|journal=Molecular Biology and Evolution|language=en|volume=33|issue=11|pages=2885–2889|doi=10.1093/molbev/msw166|issn=0737-4038|pmc=5062323|pmid=27501944|via=}}</ref>
==The code (28)==
:<code> [[Amino acid|AAs]] = FFLLSSSSYYQQCCWWLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>
:<code>[[Start codon|Starts]] = ----------**--*--------------------M----------------------------</code>
Line 16 ⟶ 15:
==Differences from the standard code==
▲{|class="wikitable" style="border: none; background: none; text-align: center;"
|-
! DNA codons
! RNA codons
! colspan="3" | This code (28)
! style="border
! [[
|-
|
|
| style="background-color:#B0B0B0;" |
| or
| style="background-color:#b3dec0;" |
| style="border
| style="background-color:#B0B0B0;" |
|-
| <
| <
| style="background-color:#B0B0B0;" | <
| or
| style="background-color:#b3dec0;" | <
| style="border
| style="background-color:#B0B0B0;" | <
|-
| <
| <
| style="background-color:#B0B0B0;" | <
| or
| style="background-color:#ffe75f;" | <
| style="border
| style="background-color:#B0B0B0;" | <
|}
==See also==
* [[List of genetic codes|List of all genetic codes]]: translation tables 1 to 16, and 21 to 31.
* [[
==References==
{{NLM content}}<ref name="NCBI">{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=18 November 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine }}</ref>
{{reflist}}
{{Authority control}}
[[Category:Molecular genetics]]
|