Peritrich nuclear code: Difference between revisions

Revision as of 16:38, 6 July 2021

Latest revision as of 17:15, 24 July 2025

(3 intermediate revisions by 3 users not shown)

Line 1:

{{Short description|An alternativeNuclear genetic code found in the nuclear genome of some ciliates}}

The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal|last1=Sánchez-Silva|first1=Rocı́o|last2=Villalobo|first2=Eduardo|last3=Morin|first3=Loı̈c|last4=Torres|first4=Antonio|year=2003|title=A New Noncanonical Nuclear Genetic Code|journal=Current Biology|volume=13|issue=5|pages=442–447|doi=10.1016/s0960-9822(03)00126-x|pmid=12620196|s2cid=17484731|doi-access=free}}</ref>

==The code (30)==

:<code>&nbsp;&nbsp;&nbsp;[[Amino acid|AAs]] = FFLLSSSSYYEECC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>

:<code>[[Start codon|Starts]] = --------------*--------------------M----------------------------</code>

Line 16 ⟶ 15:

==Differences from the standard code==

{|class="wikitable" style="border: none; background: none; text-align: center;"

{|class="wikitable" style="border: none; background: none; text-align: center;"

|+

|-

! DNA codons !! RNA codons !! This code (30) !! style="border: none; background: none; width: 1px;" | !! [[DNA_codon_tableDNA codon table|Standard code]] (1)

|-

| {{mono|TAA}} || {{mono|UAA}} || style="background-color:#f8b7d3;" | {{mono|Glu (E)}} || style="border: none; background: none; width: 1px;" | || style="background-color:#B0B0B0;" | {{mono|Ter (*)}}

|-

| {{mono|TAG}} || {{mono|UAG}} || style="background-color:#f8b7d3;" | {{mono|Glu (E)}} || style="border: none; background: none; width: 1px;" | || style="background-color:#B0B0B0;" | {{mono|Ter (*)}}

|}

==See also==

* [[List of genetic codes|List of all genetic codes]]: translation tables 1 to 16, and 21 to 31.

* [[Genetic_codes_Genetic codes (database)|The genetic codes database]].

==References==

{{NLM content}}<ref name="NCBI">{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=18 November 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), U.S.US National Library of Medicine }}</ref>

{{reflist}}

{{Authority control}}

==External links==

{{Use dmy dates|date=July 2025}}

[[Category:Molecular genetics]]