Peritrich nuclear code: Difference between revisions

Browse history interactively

← Previous edit

Content deleted Content added

VisualWikitext

Revision as of 22:00, 22 January 2017 edit Insertcleverphrasehere (talk \| contribs) Autopatrolled, Extended confirmed users, Page movers, Mass message senders, New page reviewers, Pending changes reviewers, Rollbackers 31,837 edits added Category:Genetics using HotCat ← Previous edit		Latest revision as of 17:15, 24 July 2025 edit undo Rich Farmbrough (talk \| contribs) Edit filter managers, Autopatrolled, Extended confirmed users, File movers, IP block exemptions, Pending changes reviewers, Rollbackers, Template editors 1,734,008 edits Copyedit. Date formats.
(21 intermediate revisions by 11 users not shown)
Line 1: {{Short description\|Nuclear genetic code in some ciliates}} The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal\|last=Sánchez-Silva\|first=Rocı́o\|last2=Villalobo\|first2=Eduardo\|last3=Morin\|first3=Loı̈c\|last4=Torres\|first4=Antonio\|year=2003\|title=A New Noncanonical Nuclear Genetic Code\|url=http://dx.doi.org/10.1016/S0960-9822(03)00126-X\|journal=Current Biology\|volume=13\|issue=5\|pages=442–447\|doi=10.1016/s0960-9822(03)00126-x}}</ref>▼ ▲The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal\|~~last~~last1=Sánchez-Silva\|~~first~~first1=Rocı́o\|last2=Villalobo\|first2=Eduardo\|last3=Morin\|first3=Loı̈c\|last4=Torres\|first4=Antonio\|year=2003\|title=A New Noncanonical Nuclear Genetic Code~~\|url=http://dx.doi.org/10.1016/S0960-9822(03)00126-X~~\|journal=Current Biology\|volume=13\|issue=5\|pages=442–447\|doi=10.1016/s0960-9822(03)00126-x\|pmid=12620196\|s2cid=17484731\|doi-access=free}}</ref> [[Category:Genetics]]▼ ==The code (30)== :<code>   [[Amino acid\|AAs]] = FFLLSSSSYYEECCWLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code> :<code>[[Start codon\|Starts]] = ----------------------------------M----------------------------</code> :<code> [[DNA#Nucleobase_classification\|Base1]] = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG</code> :<code> Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG</code> :<code> Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG</code> Bases: [[adenine]] (A), [[cytosine]] (C), [[guanine]] (G) and [[thymine]] (T) or [[uracil]] (U). Amino acids: [[Alanine]] (Ala, A), [[Arginine]] (Arg, R), [[Asparagine]] (Asn, N), [[Aspartic acid]] (Asp, D), [[Cysteine]] (Cys, C), [[Glutamic acid]] (Glu, E), [[Glutamine]] (Gln, Q), [[Glycine]] (Gly, G), [[Histidine]] (His, H), [[Isoleucine]] (Ile, I), [[Leucine]] (Leu, L), [[Lysine]] (Lys, K), [[Methionine]] (Met, M), [[Phenylalanine]] (Phe, F), [[Proline]] (Pro, P), [[Serine]] (Ser, S), [[Threonine]] (Thr, T), [[Tryptophan]] (Trp, W), [[Tyrosine]] (Tyr, Y), and [[Valine]] (Val, V). ==Differences from the standard code== {\|class="wikitable" style="border: none; text-align: center;" \|+ \|- ! DNA codons !! RNA codons !! This code (30) !! style="border: none; width: 1px;" \| !! [[DNA codon table\|Standard code]] (1) \|- \| {{mono\|TAA}} \|\| {{mono\|UAA}} \|\| style="background-color:#f8b7d3;" \| {{mono\|Glu (E)}} \|\| style="border: none; width: 1px;" \| \|\| style="background-color:#B0B0B0;" \| {{mono\|Ter ()}} \|- \| {{mono\|TAG}} \|\| {{mono\|UAG}} \|\| style="background-color:#f8b7d3;" \| {{mono\|Glu (E)}} \|\| style="border: none; width: 1px;" \| \|\| style="background-color:#B0B0B0;" \| {{mono\|Ter ()}} \|} ==See also== * [[List of genetic codes\|List of all genetic codes]]: translation tables 1 to 16, and 21 to 31. * [[Genetic codes (database)\|The genetic codes database]]. ==References== {{NLM content}}<ref name="NCBI">{{cite web \| first1 = Andrzej \| last1 = Elzanowski \| first2 = Jim \| last2 = Ostell \| first3 = Detlef \| last3 = Leipe \| first4 = Vladimir \| last4 = Soussov \| name-list-style = vanc \|url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop \|title= The Genetic Codes\|access-date=18 November 2016 \| work = Taxonomy browser \| publisher = National Center for Biotechnology Information (NCBI), US National Library of Medicine }}</ref> {{reflist}} {{Authority control}} {{Use dmy dates\|date=July 2025}} [[Category:Molecular genetics]] ▲[[Category:~~Genetics~~Gene expression]] [[Category:Protein biosynthesis]]