Content deleted Content added
KolbertBot (talk | contribs) m Bot: HTTP→HTTPS |
Copyedit. Date formats. |
||
(12 intermediate revisions by 9 users not shown) | |||
Line 1:
{{Short description|Nuclear genetic code in some ciliates}}
The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal|last=Sánchez-Silva|first=Rocı́o|last2=Villalobo|first2=Eduardo|last3=Morin|first3=Loı̈c|last4=Torres|first4=Antonio|year=2003|title=A New Noncanonical Nuclear Genetic Code|url=https://dx.doi.org/10.1016/S0960-9822(03)00126-X|journal=Current Biology|volume=13|issue=5|pages=442–447|doi=10.1016/s0960-9822(03)00126-x}}</ref>▼
▲The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal|
==The code (30)==▼
▲==The code (30)==
:<code> [[Amino acid|AAs]] = FFLLSSSSYYEECC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>
:<code>[[Start codon|Starts]] = --------------*--------------------M----------------------------</code>
Line 14 ⟶ 15:
==Differences from the standard code==
{|class="wikitable" style="border: none; text-align: center;"▼
▲{|class="wikitable" style="text-align: center;"
|+
|-
! DNA codons !! RNA codons !! This code (30) !! style="border: none; width: 1px;" | !! [[
|-
|
|-
|
|}
==See also==
* [[List of genetic codes|List of all genetic codes]]: translation tables 1 to 16, and 21 to 31.
* [[
==References==
{{NLM content}}<ref name="NCBI">{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=18 November 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), US National Library of Medicine }}</ref>
{{reflist}}
{{Authority control}}
{{Use dmy dates|date=July 2025}}
[[Category:Molecular genetics]]
[[Category:Gene expression]]
|