Peritrich nuclear code: Difference between revisions

Browse history interactively

← Previous edit

Content deleted Content added

VisualWikitext

Revision as of 19:39, 15 September 2020 edit Citation bot (talk \| contribs) Bots 5,868,257 edits Add: s2cid, pmid, author pars. 1-1. Removed parameters. Some additions/deletions were actually parameter name changes. \| You can use this bot yourself. Report bugs here. \| Suggested by Abductive \| Category:Gene expression \| via #UCB_Category ← Previous edit		Latest revision as of 17:15, 24 July 2025 edit undo Rich Farmbrough (talk \| contribs) Edit filter managers, Autopatrolled, Extended confirmed users, File movers, IP block exemptions, Pending changes reviewers, Rollbackers, Template editors 1,734,025 edits Copyedit. Date formats.
(5 intermediate revisions by 5 users not shown)
Line 1: {{Short description\|~~An alternative~~Nuclear genetic code ~~found~~ in ~~the nuclear genome of~~ some ciliates}} The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal\|last1=Sánchez-Silva\|first1=Rocı́o\|last2=Villalobo\|first2=Eduardo\|last3=Morin\|first3=Loı̈c\|last4=Torres\|first4=Antonio\|year=2003\|title=A New Noncanonical Nuclear Genetic Code\|journal=Current Biology\|volume=13\|issue=5\|pages=442–447\|doi=10.1016/s0960-9822(03)00126-x\|pmid=12620196\|s2cid=17484731\|doi-access=free}}</ref> ==The code (30)== :<code>   [[Amino acid\|AAs]] = FFLLSSSSYYEECCWLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code> :<code>[[Start codon\|Starts]] = ----------------------------------M----------------------------</code> Line 16 ⟶ 15: ==Differences from the standard code== {\|class="wikitable" style="border~~: none; background~~: none; text-align: center;"▼ ▲{\|class="wikitable" style="border: none; background: none; text-align: center;" \|+ \|- ! DNA codons !! RNA codons !! This code (30) !! style="border~~: none; background~~: none; width: 1px;" \| !! [[~~DNA_codon_table~~DNA codon table\|Standard code]] (1) \|- \| {{mono\|TAA}} \|\| {{mono\|UAA}} \|\| style="background-color:#f8b7d3;" \| {{mono\|Glu (E)}} \|\| style="border~~: none; background~~: none; width: 1px;" \| \|\| style="background-color:#B0B0B0;" \| {{mono\|Ter ()}} \|- \| {{mono\|TAG}} \|\| {{mono\|UAG}} \|\| style="background-color:#f8b7d3;" \| {{mono\|Glu (E)}} \|\| style="border~~: none; background~~: none; width: 1px;" \| \|\| style="background-color:#B0B0B0;" \| {{mono\|Ter ()}} \|} ==See also== * [[List of genetic codes\|List of all genetic codes]]: translation tables 1 to 16, and 21 to 31. * [[~~Genetic_codes_~~Genetic codes (database)\|The genetic codes database]]. ==References== {{NLM content}}<ref name="NCBI">{{cite web \| first1 = Andrzej \| last1 = Elzanowski \| first2 = Jim \| last2 = Ostell \| first3 = Detlef \| last3 = Leipe \| first4 = Vladimir \| last4 = Soussov \| name-list-~~format~~style = vanc \|url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop \|title= The Genetic Codes\|access-date=18 November 2016 \| work = Taxonomy browser \| publisher = National Center for Biotechnology Information (NCBI), ~~U.S.~~US National Library of Medicine }}</ref> {{reflist}} {{Authority control}} ~~==External links==~~ {{Use dmy dates\|date=July 2025}} [[Category:Molecular genetics]]