Content deleted Content added
references |
Copyedit. Date formats. |
||
| (19 intermediate revisions by 10 users not shown) | |||
Line 1:
{{Short description|Nuclear genetic code in some ciliates}}
The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal|last=Sánchez-Silva|first=Rocı́o|last2=Villalobo|first2=Eduardo|last3=Morin|first3=Loı̈c|last4=Torres|first4=Antonio|year=2003|title=A New Noncanonical Nuclear Genetic Code|url=http://dx.doi.org/10.1016/S0960-9822(03)00126-X|journal=Current Biology|volume=13|issue=5|pages=442–447|doi=10.1016/s0960-9822(03)00126-x}}</ref>▼
▲The '''peritrich nuclear code''' (translation table 30) is a [[genetic code]] used by the [[nuclear genome]] of the [[peritrich]] [[ciliates]] ''[[Vorticella]]'' and ''Opisthonecta''.<ref>{{Cite journal|
==The code (30)==▼
▲==The code (30)==
:<code> [[Amino acid|AAs]] = FFLLSSSSYYEECC*WLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>
:<code>[[Start codon|Starts]] = --------------*--------------------M----------------------------</code>
Line 13 ⟶ 14:
Amino acids: [[Alanine]] (Ala, A), [[Arginine]] (Arg, R), [[Asparagine]] (Asn, N), [[Aspartic acid]] (Asp, D), [[Cysteine]] (Cys, C), [[Glutamic acid]] (Glu, E), [[Glutamine]] (Gln, Q), [[Glycine]] (Gly, G), [[Histidine]] (His, H), [[Isoleucine]] (Ile, I), [[Leucine]] (Leu, L), [[Lysine]] (Lys, K), [[Methionine]] (Met, M), [[Phenylalanine]] (Phe, F), [[Proline]] (Pro, P), [[Serine]] (Ser, S), [[Threonine]] (Thr, T), [[Tryptophan]] (Trp, W), [[Tyrosine]] (Tyr, Y), and [[Valine]] (Val, V).
==Differences from the standard code==
== References ==▼
{|class="wikitable" style="border: none; text-align: center;"
[[Category:Genetics]]▼
|+
|-
! DNA codons !! RNA codons !! This code (30) !! style="border: none; width: 1px;" | !! [[DNA codon table|Standard code]] (1)
|-
| {{mono|TAA}} || {{mono|UAA}} || style="background-color:#f8b7d3;" | {{mono|Glu (E)}} || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | {{mono|Ter (*)}}
|-
| {{mono|TAG}} || {{mono|UAG}} || style="background-color:#f8b7d3;" | {{mono|Glu (E)}} || style="border: none; width: 1px;" | || style="background-color:#B0B0B0;" | {{mono|Ter (*)}}
|}
==See also==
* [[List of genetic codes|List of all genetic codes]]: translation tables 1 to 16, and 21 to 31.
* [[Genetic codes (database)|The genetic codes database]].
{{NLM content}}<ref name="NCBI">{{cite web | first1 = Andrzej | last1 = Elzanowski | first2 = Jim | last2 = Ostell | first3 = Detlef | last3 = Leipe | first4 = Vladimir | last4 = Soussov | name-list-style = vanc |url=https://www.ncbi.nlm.nih.gov/Taxonomy/taxonomyhome.html/index.cgi?chapter=tgencodes#thetop |title= The Genetic Codes|access-date=18 November 2016 | work = Taxonomy browser | publisher = National Center for Biotechnology Information (NCBI), US National Library of Medicine }}</ref>
{{reflist}}
{{Authority control}}
{{Use dmy dates|date=July 2025}}
[[Category:Molecular genetics]]
[[Category:Protein biosynthesis]]
| |||