Condylostoma nuclear code: Difference between revisions

Revision as of 07:39, 18 July 2025

Latest revision as of 17:04, 24 July 2025

Line 1:

{{Short description|AlternativeNuclear genetic code in some ciliates}}

{{DISPLAYTITLE:''Condylostoma'' nuclear code}}

The '''''Condylostoma'' nuclear code''' (translation table 28) is a [[genetic code]] used by the [[nuclear genome]] of the [[heterotrich]] [[ciliate]] ''[[Condylostoma]] magnum''.<ref>{{Cite journal|last=Heaphy|first=Stephen M.|last2=Mariotti|first2=Marco|last3=Gladyshev|first3=Vadim N.|last4=Atkins|first4=John F.|last5=Baranov|first5=Pavel V.|date=2016-11-01|title=Novel Ciliate Genetic Code Variants Including the Reassignment of All Three Stop Codons to Sense Codons in ''Condylostoma magnum''|journal=Molecular Biology and Evolution|language=en|volume=33|issue=11|pages=2885–2889|doi=10.1093/molbev/msw166|issn=0737-4038|pmc=5062323|pmid=27501944}}</ref><ref name="NCBI"/> This code, along with translation tables 27 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Experimental evidence suggests that translation termination relies on context, specifically proximity to the poly(A) tail. Near such a tail, [[Poly(A)-binding protein|PABP]] could help terminate the protein by recruiting eRF1 and eRF3 to prevent the cognate tRNA from binding.<ref>{{Cite journal|last=Swart|first=Estienne Carl|last2=Serra|first2=Valentina|last3=Petroni|first3=Giulio|last4=Nowacki|first4=Mariusz|title=Genetic Codes with No Dedicated Stop Codon: Context-Dependent Translation Termination|journal=Cell|volume=166|issue=3|pages=691–702|doi=10.1016/j.cell.2016.06.020|pmc=4967479|pmid=27426948|year=2016}}</ref>

==The code (28)==

:<code>&nbsp;&nbsp;&nbsp;[[Amino acid|AAs]] = FFLLSSSSYYQQCCWWLLLAPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG</code>

:<code>[[Start codon|Starts]] = ----------**--*--------------------M----------------------------</code>

Line 16 ⟶ 15:

==Differences from the standard code==

{|class="wikitable" style="border: none; text-align: center;"

|-

! DNA codons

! RNA codons

! colspan="3" | This code (28)

! style="border: none; width: 2px;" |

! [[DNA codon table|Standard code]] (1)

Line 28 ⟶ 26:

| {{mono|UAA}}

| style="background-color:#B0B0B0;" | {{mono|Ter (*)}}

| or

| style="background-color:#b3dec0;" | {{mono|Gln (Q)}}

| style="border: none; width: 2px;" |

| style="background-color:#B0B0B0;" | {{mono|Ter (*)}}

|-

| <code>TAG</code>

| <code>UAG</code>

| style="background-color:#B0B0B0;" | <code>Ter</code> <code>(*)</code>

| or

| style="background-color:#b3dec0;" | <code>Gln</code> <code>(Q)</code>

| style="border: none; width: 2px;" |

| style="background-color:#B0B0B0;" | <code>Ter</code> <code>(*)</code>

|-

| <code>TGA</code>

| <code>UGA</code>

| style="background-color:#B0B0B0;" | <code>Ter</code> <code>(*)</code>

| or

| style="background-color:#ffe75f;" | <code>Trp</code> <code>(W)</code>

| style="border: none; width: 2px;" |

| style="background-color:#B0B0B0;" | <code>Ter</code> <code>(*)</code>

|}

==See also==

* [[List of genetic codes|List of all genetic codes]]: translation tables 1 to 16, and 21 to 31.

* [[Genetic codes (database)|The genetic codes database]].

Line 58 ⟶ 56:

{{reflist}}

{{Authority control}}

[[Category:Molecular genetics]]